PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla008004
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family CO-like
Protein Properties Length: 353aa    MW: 40150.1 Da    PI: 7.6176
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla008004genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box28.14.1e-091657338
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
               +r C+ + +k+++++C  ++ +lC++C ++ H+       H+
  Cla008004 16 ARACDSCVRKRARWYCAADDAFLCQSCDSAVHSAnplarrHQ 57
               578*****************************6567777776 PP

2CCT69.21.1e-23297340144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk++
  Cla008004 297 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRT 340
                9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003369.7E-111461IPR000315B-box-type zinc finger
PROSITE profilePS5011911.0641461IPR000315B-box-type zinc finger
PfamPF006432.1E-71658IPR000315B-box-type zinc finger
CDDcd000214.47E-101761No hitNo description
PfamPF062034.4E-18297339IPR010402CCT domain
PROSITE profilePS5101716.083297339IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MMSRKSIANA VGGKTARACD SCVRKRARWY CAADDAFLCQ SCDSAVHSAN PLARRHQRLR  60
LNSATNNSKT PNYSPSWVSG FTRKPRTPRP RPKSEDLLSV VPESDDATSR SQEEEDQVSL  120
YRVPNLEQGN ELDVDLSDFA ADVESLLGRN LESECFDMEG LGLVKVEEDY CRVGQQFKGD  180
VDLMMMGEAF QLNFEEYEDD QEMKMPAVVV EVKNEREEQD ESQSNKKNRK VLSLRLDCEA  240
VIAAWGNLKS PWTNGERPDF DPHQPNWPNS MAVCGVSYGH TCGEYGVSTA AMEDSGREAR  300
VSRYREKRRT RLFSKKIRYE VRKLNAEKRP RMKGRFVKRT PFAQPTLPII SIN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1307323RRTRLFSKKIRYEVRKL
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818177e-66LN681817.1 Cucumis melo genomic scaffold, anchoredscaffold00015.
GenBankLN7132577e-66LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008445668.11e-154PREDICTED: zinc finger protein CONSTANS-LIKE 6-like
SwissprotQ8RWD09e-83COL16_ARATH; Zinc finger protein CONSTANS-LIKE 16
TrEMBLE5GC841e-154E5GC84_CUCME; Zinc finger (B-box type) family protein
STRINGVIT_01s0011g03520.t011e-105(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14733392
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.12e-77B-box type zinc finger protein with CCT domain